ENO1 polyclonal antibody
  • ENO1 polyclonal antibody

ENO1 polyclonal antibody

Ref: AB-PAB30050
ENO1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human ENO1.
Información adicional
Size 100 uL
Gene Name ENO1
Gene Alias ENO1L1|MBP-1|MPB1|NNE|PPH
Gene Description enolase 1, (alpha)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IHC-P,IF
Immunogen Prot. Seq VAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDP
Form Liquid
Recomended Dilution Immunofluorescence (1:100)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to internal region of human ENO1.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 2023

Enviar un mensaje


ENO1 polyclonal antibody

ENO1 polyclonal antibody