EIF3G polyclonal antibody
  • EIF3G polyclonal antibody

EIF3G polyclonal antibody

Ref: AB-PAB30046
EIF3G polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human EIF3G.
Información adicional
Size 100 uL
Gene Name EIF3G
Gene Alias EIF3-P42|EIF3S4|eIF3-delta|eIF3-p44
Gene Description eukaryotic translation initiation factor 3, subunit G
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq SPEPELLPGAPLPPPKEVINGNIKTVTEYKIDEDGKKFKIVRTFRIETRK
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (1.25 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human EIF3G.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 8666

Enviar un mensaje


EIF3G polyclonal antibody

EIF3G polyclonal antibody