DDX47 polyclonal antibody
  • DDX47 polyclonal antibody

DDX47 polyclonal antibody

Ref: AB-PAB30028
DDX47 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human DDX47.
Información adicional
Size 100 uL
Gene Name DDX47
Gene Alias DKFZp564O176|E4-DBP|FLJ30012|HQ0256|MSTP162
Gene Description DEAD (Asp-Glu-Ala-Asp) box polypeptide 47
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq AQRFARMELREHGEKKKRSREDAGDNDDTEGAIGVRNKVAGGKMKKRKGR
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (1.25 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to C-terminus of human DDX47.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 51202

Enviar un mensaje


DDX47 polyclonal antibody

DDX47 polyclonal antibody