DCUN1D1 polyclonal antibody
  • DCUN1D1 polyclonal antibody

DCUN1D1 polyclonal antibody

Ref: AB-PAB30024
DCUN1D1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human DCUN1D1.
Información adicional
Size 100 uL
Gene Name DCUN1D1
Gene Alias DCUN1L1|RP42|SCCRO|SCRO|Tes3
Gene Description DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq SQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENK
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (0.2-1 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human DCUN1D1.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 54165

Enviar un mensaje


DCUN1D1 polyclonal antibody

DCUN1D1 polyclonal antibody