DAZ4 polyclonal antibody
  • DAZ4 polyclonal antibody

DAZ4 polyclonal antibody

Ref: AB-PAB30018
DAZ4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human DAZ4.
Información adicional
Size 100 uL
Gene Name DAZ4
Gene Alias DAZ|DAZ1|pDP1680|pDP1681
Gene Description deleted in azoospermia 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDAR
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (0.2-1 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human DAZ4.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 57135

Enviar un mensaje


DAZ4 polyclonal antibody

DAZ4 polyclonal antibody