CTH polyclonal antibody
  • CTH polyclonal antibody

CTH polyclonal antibody

Ref: AB-PAB30014
CTH polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human CTH.
Información adicional
Size 100 uL
Gene Name CTH
Gene Alias MGC9471
Gene Description cystathionase (cystathionine gamma-lyase)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq ESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLK
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (2.5 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to C-terminus of human CTH.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 1491

Enviar un mensaje


CTH polyclonal antibody

CTH polyclonal antibody