CTDSPL polyclonal antibody
  • CTDSPL polyclonal antibody

CTDSPL polyclonal antibody

Ref: AB-PAB30013
CTDSPL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human CTDSPL.
Información adicional
Size 100 uL
Gene Name CTDSPL
Gene Alias C3orf8|HYA22|PSR1|RBSP3|SCP3
Gene Description CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,IHC-P
Immunogen Prot. Seq CCFRDYNVEAPPPSSPSVLPPLVEENGGLQKPPAKYLLPEVTVLDYGKKC
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human CTDSPL.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 10217

Enviar un mensaje


CTDSPL polyclonal antibody

CTDSPL polyclonal antibody