Ver mas grande
CREB3L2 polyclonal antibody
AB-PAB30010
Producto nuevo
CREB3L2 polyclonal antibody
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | CREB3L2 |
| Gene Alias | BBF2H7|MGC131709|MGC71006 |
| Gene Description | cAMP responsive element binding protein 3-like 2 |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ti,WB-Ce,IHC-P |
| Immunogen Prot. Seq | HSYSLCEEPRAQSPFTHITSDSFNDDEVESEKWYLSTDF |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)<br>Western Blot<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | A synthetic peptide corresponding to N-terminus of human CREB3L2. |
| Storage Buffer | In PBS (2% sucrose, 0.09% sodium azide). |
| Gene ID | 64764 |
Más información
Rabbit polyclonal antibody raised against synthetic peptide of human CREB3L2.