CLIC5 polyclonal antibody
  • CLIC5 polyclonal antibody

CLIC5 polyclonal antibody

Ref: AB-PAB30003
CLIC5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human CLIC5.
Información adicional
Size 100 uL
Gene Name CLIC5
Gene Alias CLIC5B|FLJ90663|MST130|MSTP130|dJ447E21.4
Gene Description chloride intracellular channel 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (1.25 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to C-terminus of human CLIC5.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 53405

Enviar un mensaje


CLIC5 polyclonal antibody

CLIC5 polyclonal antibody