CITED1 polyclonal antibody
  • CITED1 polyclonal antibody

CITED1 polyclonal antibody

Ref: AB-PAB29999
CITED1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human CITED1.
Información adicional
Size 100 uL
Gene Name CITED1
Gene Alias MSG1
Gene Description Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,IHC-P
Immunogen Prot. Seq IGSPTTTPPTKPPSFNLHPAPHLLASMQLQKLNSQYQGMAAATPGQPGEA
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to internal region of human CITED1.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 4435

Enviar un mensaje


CITED1 polyclonal antibody

CITED1 polyclonal antibody