C21orf33 polyclonal antibody
  • C21orf33 polyclonal antibody

C21orf33 polyclonal antibody

Ref: AB-PAB29984
C21orf33 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human C21orf33.
Información adicional
Size 100 uL
Gene Name C21orf33
Gene Alias D21S2048E|ES1|GT335|HES1|KNP-I|KNPH|KNPI
Gene Description chromosome 21 open reading frame 33
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq SRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (2.5 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human C21orf33.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 8209

Enviar un mensaje


C21orf33 polyclonal antibody

C21orf33 polyclonal antibody