BHMT polyclonal antibody
  • BHMT polyclonal antibody

BHMT polyclonal antibody

Ref: AB-PAB29978
BHMT polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human BHMT.
Información adicional
Size 100 uL
Gene Name BHMT
Gene Alias -
Gene Description betaine-homocysteine methyltransferase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IHC-P
Immunogen Prot. Seq KHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVT
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to C-terminus of human BHMT.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 635

Enviar un mensaje


BHMT polyclonal antibody

BHMT polyclonal antibody