ASS1 polyclonal antibody
  • ASS1 polyclonal antibody

ASS1 polyclonal antibody

Ref: AB-PAB29974
ASS1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human ASS1.
Información adicional
Size 100 uL
Gene Name ASS1
Gene Alias ASS|CTLN1
Gene Description argininosuccinate synthetase 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq SVLKGQVYILGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRLKE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (2.5 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to C-terminus of human ASS1.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 445

Enviar un mensaje


ASS1 polyclonal antibody

ASS1 polyclonal antibody