ARRB2 polyclonal antibody
  • ARRB2 polyclonal antibody

ARRB2 polyclonal antibody

Ref: AB-PAB29967
ARRB2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human ARRB2.
Información adicional
Size 100 uL
Gene Name ARRB2
Gene Alias ARB2|ARR2|BARR2|DKFZp686L0365
Gene Description arrestin, beta 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,IHC-P
Immunogen Prot. Seq RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to internal region of human ARRB2.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 409

Enviar un mensaje


ARRB2 polyclonal antibody

ARRB2 polyclonal antibody