ALDH4A1 polyclonal antibody
  • ALDH4A1 polyclonal antibody

ALDH4A1 polyclonal antibody

Ref: AB-PAB29957
ALDH4A1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human ALDH4A1.
Información adicional
Size 100 uL
Gene Name ALDH4A1
Gene Alias ALDH4|P5CD|P5CDh|P5CDhL|P5CDhS
Gene Description aldehyde dehydrogenase 4 family, member A1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq QGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (2.5 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human ALDH4A1.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 8659

Enviar un mensaje


ALDH4A1 polyclonal antibody

ALDH4A1 polyclonal antibody