SFRS17A polyclonal antibody
  • SFRS17A polyclonal antibody

SFRS17A polyclonal antibody

Ref: AB-PAB29955
SFRS17A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human SFRS17A.
Información adicional
Size 100 uL
Gene Name SFRS17A
Gene Alias 721P|CCDC133|CXYorf3|DXYS155E|MGC125365|MGC125366|MGC39904|XE7|XE7Y
Gene Description splicing factor, arginine/serine-rich 17A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq NWEVMERLKGMVQNHQFSTLRISKSTMDFIRFEGEVENKSLVKSFLACLD
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (0.2-1 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human SFRS17A.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 8227

Enviar un mensaje


SFRS17A polyclonal antibody

SFRS17A polyclonal antibody