ACTR2 polyclonal antibody
  • ACTR2 polyclonal antibody

ACTR2 polyclonal antibody

Ref: AB-PAB29950
ACTR2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human ACTR2.
Información adicional
Size 100 uL
Gene Name ACTR2
Gene Alias ARP2
Gene Description ARP2 actin-related protein 2 homolog (yeast)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq NGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNREKIVE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (2.5 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human ACTR2.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 10097

Enviar un mensaje


ACTR2 polyclonal antibody

ACTR2 polyclonal antibody