MFI2 polyclonal antibody
  • MFI2 polyclonal antibody

MFI2 polyclonal antibody

Ref: AB-PAB29944
MFI2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human MFI2.
Información adicional
Size 100 uL
Gene Name MFI2
Gene Alias CD228|FLJ38863|MAP97|MGC4856|MTF1
Gene Description antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IF
Immunogen Prot. Seq CVPVNNPKNYPSSLCALCVGDEQGRNKCVGNSQERYYGYRGAFRCLVENA
Form Liquid
Recomended Dilution Immunofluorescence (1:50)
Western Blot (0.2-1 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to C-terminus of human MFI2.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 4241

Enviar un mensaje


MFI2 polyclonal antibody

MFI2 polyclonal antibody