HNRNPH1 polyclonal antibody
  • HNRNPH1 polyclonal antibody

HNRNPH1 polyclonal antibody

Ref: AB-PAB29941
HNRNPH1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human HNRNPH1.
Información adicional
Size 100 uL
Gene Name HNRNPH1
Gene Alias DKFZp686A15170|HNRPH|HNRPH1|hnRNPH
Gene Description heterogeneous nuclear ribonucleoprotein H1 (H)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF,IP
Immunogen Prot. Seq FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG
Form Liquid
Recomended Dilution Immunofluorescence (1:200)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (5 ug/mL)
Immunoprecipitation (1:4000)
Western Blot
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to internal region of human HNRNPH1.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 3187

Enviar un mensaje


HNRNPH1 polyclonal antibody

HNRNPH1 polyclonal antibody