CENPN polyclonal antibody
  • CENPN polyclonal antibody

CENPN polyclonal antibody

Ref: AB-PAB29940
CENPN polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human CENPN.
Información adicional
Size 100 uL
Gene Name CENPN
Gene Alias BM039|C16orf60|CENP-N|FLJ13607|FLJ22660
Gene Description centromere protein N
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IF
Immunogen Prot. Seq SFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYS
Form Liquid
Recomended Dilution Immunofluorescence (1:250)
Western Blot (0.2-1 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to internal region of human CENPN.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 55839

Enviar un mensaje


CENPN polyclonal antibody

CENPN polyclonal antibody