CENPI polyclonal antibody
  • CENPI polyclonal antibody

CENPI polyclonal antibody

Ref: AB-PAB29939
CENPI polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human CENPI.
Información adicional
Size 100 uL
Gene Name CENPI
Gene Alias CENP-I|FSHPRH1|LRPR1|Mis6
Gene Description centromere protein I
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IF
Immunogen Prot. Seq SPQKRVKNVQAQNRTSQGSSSFQTTLSAWKVKQDPSNSKNISKHGQNNPV
Form Liquid
Recomended Dilution Immunofluorescence
Western Blot (0.2-1 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human CENPI.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 2491

Enviar un mensaje


CENPI polyclonal antibody

CENPI polyclonal antibody