CHI3L1 polyclonal antibody
  • CHI3L1 polyclonal antibody

CHI3L1 polyclonal antibody

Ref: AB-PAB29938
CHI3L1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human CHI3L1.
Información adicional
Size 100 uL
Gene Name CHI3L1
Gene Alias ASRT7|DKFZp686N19119|FLJ38139|GP39|HC-gp39|HCGP-3P|YKL40|YYL-40
Gene Description chitinase 3-like 1 (cartilage glycoprotein-39)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IF
Immunogen Prot. Seq LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRL
Form Liquid
Recomended Dilution Immunofluorescence (1:2000)
Western Blot (0.2-1 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to internal region of human CHI3L1.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 1116

Enviar un mensaje


CHI3L1 polyclonal antibody

CHI3L1 polyclonal antibody