DLL1 polyclonal antibody
  • DLL1 polyclonal antibody

DLL1 polyclonal antibody

Ref: AB-PAB29935
DLL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human DLL1.
Información adicional
Size 100 uL
Gene Name DLL1
Gene Alias DELTA1|DL1|Delta
Gene Description delta-like 1 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGP
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Western Blot (0.2-1 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human DLL1.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 28514

Enviar un mensaje


DLL1 polyclonal antibody

DLL1 polyclonal antibody