PSG1 polyclonal antibody
  • PSG1 polyclonal antibody

PSG1 polyclonal antibody

Ref: AB-PAB29928
PSG1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human PSG1.
Información adicional
Size 100 uL
Gene Name PSG1
Gene Alias B1G1|CD66f|DHFRP2|FLJ90598|FLJ90654|PBG1|PSBG1|PSGGA|PSGIIA|SP1
Gene Description pregnancy specific beta-1-glycoprotein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq SGRETAYSNASLLIQNVTREDAGSYTLHIIKGDDGTRGVTGRFTFTLHLE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (2.5 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human PSG1.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 5669

Enviar un mensaje


PSG1 polyclonal antibody

PSG1 polyclonal antibody