MGST2 polyclonal antibody
  • MGST2 polyclonal antibody

MGST2 polyclonal antibody

Ref: AB-PAB29911
MGST2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial synthetic protein of human MGST2.
Información adicional
Size 100 uL
Gene Name MGST2
Gene Alias FLJ27438|GST2|MGC14097|MGST-II
Gene Description microsomal glutathione S-transferase 2
Storage Conditions Store at 4C for up to one week. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq MAGNSILLAAVSILSACQQSYFALQVGKARLKYKVTPPAVTGSPEFERVF
Form Liquid
Recomended Dilution Immunohistochemistry (1:250)
Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to amino acids 1-50 of human MGST2.
Storage Buffer In 1X PBS , pH 7.4 (2% sucrose, 0.09% sodium azide).
Gene ID 4258
Iso type IgG

Enviar un mensaje


MGST2 polyclonal antibody

MGST2 polyclonal antibody