L3MBTL2 polyclonal antibody
  • L3MBTL2 polyclonal antibody

L3MBTL2 polyclonal antibody

Ref: AB-PAB29902
L3MBTL2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial synthetic protein of human L3MBTL2.
Información adicional
Size 100 uL
Gene Name L3MBTL2
Gene Alias H-l(3)mbt-l|L3MBT
Gene Description l(3)mbt-like 2 (Drosophila)
Storage Conditions Store at 4C for up to one week. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq EYDQWVDCESPDIYPVGWCELTGYQLQPPVAAEPATPLKAKEATKKKKKQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:250)
Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to amino acids 576-625 of human L3MBTL2.
Storage Buffer In 1X PBS , pH 7.4 (2% sucrose, 0.09% sodium azide).
Gene ID 83746
Iso type IgG

Enviar un mensaje


L3MBTL2 polyclonal antibody

L3MBTL2 polyclonal antibody