KRT15 polyclonal antibody
  • KRT15 polyclonal antibody

KRT15 polyclonal antibody

Ref: AB-PAB29899
KRT15 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial synthetic protein of human KRT15.
Información adicional
Size 100 uL
Gene Name KRT15
Gene Alias CK15|K15|K1CO
Gene Description keratin 15
Storage Conditions Store at 4C for up to one week. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,IHC-P
Immunogen Prot. Seq RSLLEGQDAKMAGIGIREASSGGGGSSSNFHINVEESVDGQVVSSHKREI
Form Liquid
Recomended Dilution Immunohistochemistry (1:250)
Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to amino acids 407-456 of human KRT15.
Storage Buffer In 1X PBS , pH 7.4 (2% sucrose, 0.09% sodium azide).
Gene ID 3866
Iso type IgG

Enviar un mensaje


KRT15 polyclonal antibody

KRT15 polyclonal antibody