RBPMS polyclonal antibody
  • RBPMS polyclonal antibody

RBPMS polyclonal antibody

Ref: AB-PAB29896
RBPMS polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial synthetic protein of human RBPMS.
Información adicional
Size 100 uL
Gene Name RBPMS
Gene Alias HERMES
Gene Description RNA binding protein with multiple splicing
Storage Conditions Store at 4C for up to one week. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IHC-P,ICC
Immunogen Prot. Seq LFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGIRFDPEIPQ
Form Liquid
Recomended Dilution Immunocytochemistry (1:250)
Immunohistochemistry (1:250)
Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to amino acids 43-92 of human RBPMS.
Storage Buffer In 1X PBS , pH 7.4 (2% sucrose, 0.09% sodium azide).
Gene ID 11030
Iso type IgG

Enviar un mensaje


RBPMS polyclonal antibody

RBPMS polyclonal antibody