KLHL25 polyclonal antibody
  • KLHL25 polyclonal antibody

KLHL25 polyclonal antibody

Ref: AB-PAB29895
KLHL25 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial synthetic protein of human KLHL25.
Información adicional
Size 100 uL
Gene Name KLHL25
Gene Alias ENC-2|ENC2|FLJ12587|FLJ45015
Gene Description kelch-like 25 (Drosophila)
Storage Conditions Store at 4C for up to one week. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq RLYEFSWRMCLVHFETVRQSEDFNSLSKDTLLDLISSDELETEDERVVFE
Form Liquid
Recomended Dilution Immunohistochemistry (1:250)
Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to amino acids 163-212 of human KLHL25.
Storage Buffer In 1X PBS , pH 7.4 (2% sucrose, 0.09% sodium azide).
Gene ID 64410
Iso type IgG

Enviar un mensaje


KLHL25 polyclonal antibody

KLHL25 polyclonal antibody