KLF8 polyclonal antibody
  • KLF8 polyclonal antibody

KLF8 polyclonal antibody

Ref: AB-PAB29893
KLF8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial synthetic protein of human KLF8.
Información adicional
Size 100 uL
Gene Name KLF8
Gene Alias BKLF3|DKFZp686O08126|DXS741|MGC138314|ZNF741
Gene Description Kruppel-like factor 8
Storage Conditions Store at 4C for up to one week. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IHC-P
Immunogen Prot. Seq LSFHKPKAPLQPASMLQAPIRPPKPQSSPQTLVVSTSTSDMSTSANIPTV
Form Liquid
Recomended Dilution Immunohistochemistry (1:250)
Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to amino acids 89-138 of human KLF8.
Storage Buffer In 1X PBS , pH 7.4 (2% sucrose, 0.09% sodium azide).
Gene ID 11279
Iso type IgG

Enviar un mensaje


KLF8 polyclonal antibody

KLF8 polyclonal antibody