SF3A1 polyclonal antibody
  • SF3A1 polyclonal antibody

SF3A1 polyclonal antibody

Ref: AB-PAB29879
SF3A1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial synthetic protein of human SF3A1.
Información adicional
Size 100 uL
Gene Name SF3A1
Gene Alias PRP21|PRPF21|SAP114|SF3A120
Gene Description splicing factor 3a, subunit 1, 120kDa
Storage Conditions Store at 4C for up to 1 week. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq QQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLT
Form Liquid
Recomended Dilution Immunofluorescence (1:250)
Immunohistochemistry (1:250)
Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to amino acids 121-170 of human SF3A1.
Storage Buffer In PBS, pH 7.4 (2% sucrose, 0.09% sodium azide).
Gene ID 10291
Iso type IgG

Enviar un mensaje


SF3A1 polyclonal antibody

SF3A1 polyclonal antibody