OVOL2 polyclonal antibody
  • OVOL2 polyclonal antibody

OVOL2 polyclonal antibody

Ref: AB-PAB29877
OVOL2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial synthetic protein of human OVOL2.
Información adicional
Size 100 uL
Gene Name OVOL2
Gene Alias EUROIMAGE566589|ZNF339
Gene Description ovo-like 2 (Drosophila)
Storage Conditions Store at 4C for up to 1 week. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IF
Immunogen Prot. Seq QEDLYLHVNSAHPGSSFLKKTSKKLAALLQGKLTSAHQENTSLSEEEERK
Form Liquid
Recomended Dilution Immunofluorescence
Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to amino acids 226-275 of human OVOL2.
Storage Buffer In PBS, pH 7.4 (2% sucrose, 0.09% sodium azide).
Gene ID 58495
Iso type IgG

Enviar un mensaje


OVOL2 polyclonal antibody

OVOL2 polyclonal antibody