RBBP9 polyclonal antibody
  • RBBP9 polyclonal antibody

RBBP9 polyclonal antibody

Ref: AB-PAB29869
RBBP9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial synthetic protein of human RBBP9.
Información adicional
Size 100 uL
Gene Name RBBP9
Gene Alias BOG|MGC9236|RBBP10
Gene Description retinoblastoma binding protein 9
Storage Conditions Store at 4C for up to 1 week. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IF
Immunogen Prot. Seq MASPSKAVIVPGNGGGDVTTHGWYGWVKKELEKIPGFQCLAKNMPDPITA
Form Liquid
Recomended Dilution Immunofluorescence (1:150)
Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to amino acids 1-50 of human RBBP9.
Storage Buffer In PBS, pH 7.4 (2% sucrose, 0.09% sodium azide).
Gene ID 10741
Iso type IgG

Enviar un mensaje


RBBP9 polyclonal antibody

RBBP9 polyclonal antibody