HOXB7 polyclonal antibody
  • HOXB7 polyclonal antibody

HOXB7 polyclonal antibody

Ref: AB-PAB29868
HOXB7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial synthetic protein of human HOXB7.
Información adicional
Size 100 uL
Gene Name HOXB7
Gene Alias HHO.C1|HOX2|HOX2C|Hox-2.3
Gene Description homeobox B7
Storage Conditions Store at 4C for up to 1 week. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq IEIAHTLCLTERQIKIWFQNRRMKWKKENKTAGPGTTGQDRAEAEEEEEE
Form Liquid
Recomended Dilution Immunofluorescence (1:250)
Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to amino acids 168-217 of human HOXB7.
Storage Buffer In PBS, pH 7.4 (2% sucrose, 0.09% sodium azide).
Gene ID 3217
Iso type IgG

Enviar un mensaje


HOXB7 polyclonal antibody

HOXB7 polyclonal antibody