HIC2 polyclonal antibody
  • HIC2 polyclonal antibody

HIC2 polyclonal antibody

Ref: AB-PAB29865
HIC2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial synthetic protein of human HIC2.
Información adicional
Size 100 uL
Gene Name HIC2
Gene Alias HRG22|KIAA1020|ZBTB30
Gene Description hypermethylated in cancer 2
Storage Conditions Store at 4C for up to 1 week. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,IF
Immunogen Prot. Seq CKEEEENGKDASEDSAQSGSEGGSGHASAHYMYRQEGYETVSYGDNLYVC
Form Liquid
Recomended Dilution Immunofluorescence (1:250)
Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to amino acids 395-444 of human HIC2.
Storage Buffer In PBS, pH 7.4 (2% sucrose, 0.09% sodium azide).
Gene ID 23119
Iso type IgG

Enviar un mensaje


HIC2 polyclonal antibody

HIC2 polyclonal antibody