Pax7 polyclonal antibody
  • Pax7 polyclonal antibody

Pax7 polyclonal antibody

Ref: AB-PAB29864
Pax7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial synthetic protein of rat Pax7.
Información adicional
Size 100 uL
Gene Name Pax7
Gene Alias RGD1564360
Gene Description paired box 7
Storage Conditions Store at 4C for up to 1 week. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IF
Immunogen Prot. Seq SDVESEPDLPLKRKQRRSRTTFTAEQLEELEKAFERTHYPDIYTREELAQ
Form Liquid
Recomended Dilution Immunofluorescence (1:200)
Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Rat
Immunogen A synthetic peptide corresponding to amino acids 201-250 of rat Pax7.
Storage Buffer In PBS, pH 7.4 (2% sucrose, 0.09% sodium azide).
Gene ID 500574
Iso type IgG

Enviar un mensaje


Pax7 polyclonal antibody

Pax7 polyclonal antibody