CD226 polyclonal antibody
  • CD226 polyclonal antibody

CD226 polyclonal antibody

Ref: AB-PAB29582
CD226 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CD226.
Información adicional
Size 100 uL
Gene Name CD226
Gene Alias DNAM-1|DNAM1|PTA1|TLiSA1
Gene Description CD226 molecule
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq DVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDNQYTL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 102-251 of human CD226.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10666
Iso type IgG

Enviar un mensaje


CD226 polyclonal antibody

CD226 polyclonal antibody