PVR polyclonal antibody
  • PVR polyclonal antibody

PVR polyclonal antibody

Ref: AB-PAB29579
PVR polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PVR.
Información adicional
Size 100 uL
Gene Name PVR
Gene Alias CD155|FLJ25946|HVED|NECL5|Necl-5|PVS|TAGE4
Gene Description poliovirus receptor
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq DVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFP
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 28-129 of human PVR.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5817
Iso type IgG

Enviar un mensaje


PVR polyclonal antibody

PVR polyclonal antibody