VCAM1 polyclonal antibody
  • VCAM1 polyclonal antibody

VCAM1 polyclonal antibody

Ref: AB-PAB29573
VCAM1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human VCAM1.
Información adicional
Size 100 uL
Gene Name VCAM1
Gene Alias CD106|DKFZp779G2333|INCAM-100|MGC99561
Gene Description vascular cell adhesion molecule 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IGDSVMLTCSVMGCESPSFSWRTQIDSPLSGKVRSEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIEMSG
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human VCAM1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7412
Iso type IgG

Enviar un mensaje


VCAM1 polyclonal antibody

VCAM1 polyclonal antibody