CDH2 polyclonal antibody
  • CDH2 polyclonal antibody

CDH2 polyclonal antibody

Ref: AB-PAB29571
CDH2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human CDH2.
Información adicional
Size 100 uL
Gene Name CDH2
Gene Alias CD325|CDHN|CDw325|NCAD
Gene Description cadherin 2, type 1, N-cadherin (neuronal)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDP
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CDH2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1000
Iso type IgG

Enviar un mensaje


CDH2 polyclonal antibody

CDH2 polyclonal antibody