LY75 polyclonal antibody
  • LY75 polyclonal antibody

LY75 polyclonal antibody

Ref: AB-PAB29569
LY75 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human LY75.
Información adicional
Size 100 uL
Gene Name LY75
Gene Alias CD205|CLEC13B|DEC-205|GP200-MR6
Gene Description lymphocyte antigen 75
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq LRWTAYEKINKWTDNRELTYSNFHPLLVSGRLRIPENFFEEESRYHCALILNLQKSPFTGTWNFTSCSERHFVSLCQKYSEVKSRQTLQNASETVKYLNN
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LY75.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4065
Iso type IgG

Enviar un mensaje


LY75 polyclonal antibody

LY75 polyclonal antibody