CD47 polyclonal antibody
  • CD47 polyclonal antibody

CD47 polyclonal antibody

Ref: AB-PAB29568
CD47 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human CD47.
Información adicional
Size 100 uL
Gene Name CD47
Gene Alias IAP|MER6|OA3
Gene Description CD47 molecule
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVS
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CD47.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 961
Iso type IgG

Enviar un mensaje


CD47 polyclonal antibody

CD47 polyclonal antibody