KIT polyclonal antibody
  • KIT polyclonal antibody

KIT polyclonal antibody

Ref: AB-PAB29551
KIT polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human KIT.
Información adicional
Size 100 uL
Gene Name KIT
Gene Alias C-Kit|CD117|PBT|SCFR
Gene Description v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human KIT.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3815
Iso type IgG

Enviar un mensaje


KIT polyclonal antibody

KIT polyclonal antibody