SUSD2 polyclonal antibody
  • SUSD2 polyclonal antibody

SUSD2 polyclonal antibody

Ref: AB-PAB29550
SUSD2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human SUSD2.
Información adicional
Size 100 uL
Gene Name SUSD2
Gene Alias BK65A6.2|FLJ22778
Gene Description sushi domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MDLKGMFLSVAAGDRVSIMLASGAGLEVSVQGPFLSVSVLLPEKFLTHTHGLLGTLNNDPTDDFTLHSGRVLPPGTSPQELFLFGANWTVHNASSLLTYDSWFLVHNFLYQPKHDPTFEPLFPSETTLNPSLAQEAAKLCGDDHFCNF
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SUSD2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56241
Iso type IgG

Enviar un mensaje


SUSD2 polyclonal antibody

SUSD2 polyclonal antibody