ELF3 polyclonal antibody
  • ELF3 polyclonal antibody

ELF3 polyclonal antibody

Ref: AB-PAB29549
ELF3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human ELF3.
Información adicional
Size 100 uL
Gene Name ELF3
Gene Alias EPR-1|ERT|ESE-1|ESX
Gene Description E74-like factor 3 (ets domain transcription factor, epithelial-specific )
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq ATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWLGEQPQFWSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSSSDELSWIIELLEKDGMA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ELF3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1999
Iso type IgG

Enviar un mensaje


ELF3 polyclonal antibody

ELF3 polyclonal antibody