ATF7 polyclonal antibody
  • ATF7 polyclonal antibody

ATF7 polyclonal antibody

Ref: AB-PAB29544
ATF7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human ATF7.
Información adicional
Size 100 uL
Gene Name ATF7
Gene Alias ATFA|MGC57182
Gene Description activating transcription factor 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LPGPPVQMPSVISLARPVSMVPNIPGIPGPPVNSSGSISPSGHPIPSEAKMRLKATLTHQVSSINGGCGMVVGTASTMVTARPEQSQILIQHPDAPSPAQPQVSPAQPTPSTGGRRRRTVDEDPDERRQRFLE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ATF7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 11016
Iso type IgG

Enviar un mensaje


ATF7 polyclonal antibody

ATF7 polyclonal antibody