BRPF1 polyclonal antibody
  • BRPF1 polyclonal antibody

BRPF1 polyclonal antibody

Ref: AB-PAB29543
BRPF1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human BRPF1.
Información adicional
Size 100 uL
Gene Name BRPF1
Gene Alias BR140
Gene Description bromodomain and PHD finger containing, 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SLAGDEATHHTEDAAEEERLVLLENQKHLPVEEQLKLLLERLDEVNASKQSVGRSRRAKMIKKEMTALRRKLAHQRETGRDGPERHGPSSRGSLTPHPAACDKDGQTD
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human BRPF1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7862
Iso type IgG

Enviar un mensaje


BRPF1 polyclonal antibody

BRPF1 polyclonal antibody