UBE2E3 polyclonal antibody
  • UBE2E3 polyclonal antibody

UBE2E3 polyclonal antibody

Ref: AB-PAB29537
UBE2E3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human UBE2E3.
Información adicional
Size 100 uL
Gene Name UBE2E3
Gene Alias UBCH9|UbcM2
Gene Description ubiquitin-conjugating enzyme E2E 3 (UBC4/5 homolog, yeast)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq SSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTKLSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human UBE2E3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10477
Iso type IgG

Enviar un mensaje


UBE2E3 polyclonal antibody

UBE2E3 polyclonal antibody