NEUROD1 polyclonal antibody
  • NEUROD1 polyclonal antibody

NEUROD1 polyclonal antibody

Ref: AB-PAB29535
NEUROD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human NEUROD1.
Información adicional
Size 100 uL
Gene Name NEUROD1
Gene Alias BETA2|BHF-1|NEUROD|bHLHa3
Gene Description neurogenic differentiation 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq ASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFTMHYPAATLAGAQSHGSIFSGTAAPRCEIPIDNIMSFDSHSHHERVMSAQL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human NEUROD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4760
Iso type IgG

Enviar un mensaje


NEUROD1 polyclonal antibody

NEUROD1 polyclonal antibody