MB polyclonal antibody
  • MB polyclonal antibody

MB polyclonal antibody

Ref: AB-PAB29530
MB polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human MB.
Información adicional
Size 100 uL
Gene Name MB
Gene Alias MGC13548|PVALB
Gene Description myoglobin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human MB.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4151
Iso type IgG

Enviar un mensaje


MB polyclonal antibody

MB polyclonal antibody